PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.9K9IH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family bHLH
Protein Properties Length: 256aa    MW: 29348.5 Da    PI: 6.7936
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.9K9IHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH40.26.3e-1354103455
                  HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH   4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                  +hn++Er RR++iN  ++ Lr++lP a   + kK+s  ++  ++ +YI +Lq
  Aradu.9K9IH  54 NHNANERHRRKKINALYSSLRSILPVA--DQTKKMSIPATISRVLKYIPELQ 103
                  8*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.31E-1550120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.45250102IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.56E-1051107No hitNo description
Gene3DG3DSA:4.10.280.101.1E-1152116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.9E-1054103IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.5E-1056108IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MSMMLALSSP TSMFPNNMEW PLELEEEELS HSHHEYFNSE EYPLLSSSMA KKFNHNANER  60
HRRKKINALY SSLRSILPVA DQTKKMSIPA TISRVLKYIP ELQQQVEELI KKKEELLLRI  120
SRQGDINNDD AAAAAAMNKK GHHHQNSSGF LVSSSTISDS EVSIQIISSY GIQKCQVSEI  180
LVCLENHYAL QLLNASSFDT FGGRLFYNLH FQMEMAHTLD TEVLSEKILS ICEKHQRIYL  240
CNVNNTYKYF LFLVIA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015969203.11e-176PREDICTED: transcription factor bHLH100-like isoform X1
TrEMBLA0A151RUV66e-69A0A151RUV6_CAJCA; Transcription factor ORG2
STRINGGLYMA03G28630.14e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41240.11e-26basic helix-loop-helix protein 100